PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000818967
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NF-YB
Protein Properties Length: 195aa    MW: 20837 Da    PI: 6.9473
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000818967genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB183.81.3e-5720115297
          NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                    reqdr+lPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yveplkvyl+++re+egek
  MDP0000818967  20 REQDRLLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKVYLQRFREMEGEK 115
                    89********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.4E-5614144IPR009072Histone-fold
SuperFamilySSF471132.95E-4122131IPR009072Histone-fold
PfamPF008081.1E-272589IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006157.7E-215371No hitNo description
PROSITE patternPS0068505672IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006157.7E-217290No hitNo description
PRINTSPR006157.7E-2191109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MADSDNDSGG AHTKSELSPR EQDRLLPIAN VSRIMKKALP ANAKISKDAK ETVQECVSEF  60
ISFITGEASD KCQREKRKTI NGDDLLWAMT TLGFEEYVEP LKVYLQRFRE MEGEKSSVSA  120
RDKDGSGGGN GGVGYEGGGG SSGGAGVYWQ QQQQQQQQQQ HQGHVYGGSG FHQMGVSGVG  180
MGKSGSGSNM GRPR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B5e-4817110194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A5e-4817110194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892182e-80AC189218.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB010F13, complete sequence.
GenBankKT0311582e-80KT031158.1 Glycine max clone HN_CCL_197 CCAAT transcription factor (Glyma15g12570.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008376324.11e-141PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233104e-73NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLM5WHU02e-98M5WHU0_PRUPE; Uncharacterized protein
STRINGGLYMA18G08620.16e-89(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.13e-74nuclear factor Y, subunit B3